DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment up and tnnt2b

DIOPT Version :9

Sequence 1:NP_001162742.1 Gene:up / 32314 FlyBaseID:FBgn0004169 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_017212238.1 Gene:tnnt2b / 100331199 ZFINID:ZDB-GENE-091106-2 Length:243 Species:Danio rerio


Alignment Length:273 Identity:82/273 - (30%)
Similarity:130/273 - (47%) Gaps:56/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDDEEYTSSEEEEVVEE--TREETK-------PPQTPAEGEGDPEFIKRQDQKRSDLDD----Q 52
            ||:..|:  .::|:.|||  ..||||       ||..|.         |..|.::.|.||    :
Zfish     1 MSEGVEH--EKQEDAVEEPGEEEETKPKHKTFLPPHVPP---------KIPDGEKVDFDDIHRKR 54

  Fly    53 LKEYITEWR-------KQRSKEEDELKKLKEKQAKRKVTRAEEEQKMAQRKKEEEERRVREAEEK 110
            :::.:||.:       ::|.|||:||..|.::...|:..|||:::...:|.:|            
Zfish    55 MEKDLTELQTLIEAHFEKRKKEEEELINLTQRIENRRSERAEQQRIRTERDRE------------ 107

  Fly   111 KQREIEEKRMRLEEAEKKRQAMLQAMKDKDKKGPNFTIAKKDAGVLGLSSAAMERNKTKEQLE-E 174
            :|.::.|::.|.||.|.||:|...|.|.|......:|         |......:|...|:|.| |
Zfish   108 RQNKLAEEKARKEEEEAKRKADDDAKKKKVLTSFQYT---------GYMQRTEKRGGPKKQTERE 163

  Fly   175 EKKISLSFRIKPLAIEGFGEAKLREKAQELWELIVKLETEKYDLEERQKRQDYDLKELKER---Q 236
            :||..||.|.|.|.||..|..||||.|.|||:.:.:||.||:::..:...|.|::..|:.|   .
Zfish   164 KKKTILSERRKELNIENIGADKLRETANELWKKMRQLEAEKFEMHYKYMSQKYEITVLRNRVSDH 228

  Fly   237 KQQLRHKALKKGL 249
            ::..:....|:||
Zfish   229 QKNTKGSRSKRGL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
upNP_001162742.1 Troponin 156..>233 CDD:395788 30/77 (39%)
tnnt2bXP_017212238.1 Troponin 53..188 CDD:307228 46/155 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592579
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4719
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11521
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.