DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11816 and Cpr12A

DIOPT Version :10

Sequence 1:NP_001259515.1 Gene:CG11816 / 32310 FlyBaseID:FBgn0030495 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_572896.1 Gene:Cpr12A / 32309 FlyBaseID:FBgn0030494 Length:173 Species:Drosophila melanogaster


Alignment Length:62 Identity:17/62 - (27%)
Similarity:32/62 - (51%) Gaps:2/62 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 HPNGTEEYKLVMSNGLVNYKKLYSKKVGDRLINVQEGYNSVPIPGPKNQIQTQYYIADERGY 333
            :|:|:.||:..:.:|...|::.|..|:.|....:..||.:..:  ...:..|.:|.||:.||
  Fly    41 YPDGSYEYRFELDDGTARYERGYFVKINDVKTLMVVGYYAYRM--TDGRYITVFYNADQFGY 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11816NP_001259515.1 None
Cpr12ANP_572896.1 Chitin_bind_4 46..100 CDD:459790 13/55 (24%)

Return to query results.
Submit another query.