Sequence 1: | NP_078777.1 | Gene: | HOXD1 / 3231 | HGNCID: | 5132 | Length: | 328 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_996167.1 | Gene: | Antp / 40835 | FlyBaseID: | FBgn0260642 | Length: | 378 | Species: | Drosophila melanogaster |
Alignment Length: | 244 | Identity: | 70/244 - (28%) |
---|---|---|---|
Similarity: | 94/244 - (38%) | Gaps: | 81/244 - (33%) |
- Green bases have known domain annotations that are detailed below.
Human 82 YAQCTLEGAYEPGAAPAAAAGGADYGFLGSGPAYDFPGVLGRAADDGGSHVHYATSAVFSGGGSF 146
Human 147 LLSGQVDYAAFGEP------------------------------------GPFPACLKASADGHP 175
Human 176 GAFQTASPAPGTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFSTKQ 240
Human 241 LTELEKEFHFNKYLTRARRIEIANCLHLNDTQVKIWFQNRRMKQKKRER 289 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HOXD1 | NP_078777.1 | Antp-type hexapeptide | 204..209 | 1/4 (25%) | |
Homeobox | 233..285 | CDD:278475 | 34/51 (67%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 305..328 | ||||
Antp | NP_996167.1 | KLF1_2_4_N | <161..306 | CDD:425360 | 33/189 (17%) |
Homeobox | 301..354 | CDD:395001 | 34/52 (65%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X14 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |