Sequence 1: | NP_078777.1 | Gene: | HOXD1 / 3231 | HGNCID: | 5132 | Length: | 328 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001368995.1 | Gene: | Scr / 40833 | FlyBaseID: | FBgn0003339 | Length: | 564 | Species: | Drosophila melanogaster |
Alignment Length: | 209 | Identity: | 67/209 - (32%) |
---|---|---|---|
Similarity: | 90/209 - (43%) | Gaps: | 57/209 - (27%) |
- Green bases have known domain annotations that are detailed below.
Human 93 PGAAPAAAAGGADYGFLGSGPAYDFPGVLGRAADDGGSHVHYATSAVFSGGGSFLLSGQVDYAAF 157
Human 158 GEPGPFPACLKASADGHPGAFQTASPA----PGTYPKSVSPASGLPAAFSTFEWMK--------V 210
Human 211 KRNASKKGKLAEYGAASPSSAIRTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLHLNDTQVKI 275
Human 276 WFQNRRMKQKKRER 289 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HOXD1 | NP_078777.1 | Antp-type hexapeptide | 204..209 | 1/4 (25%) | |
Homeobox | 233..285 | CDD:278475 | 35/51 (69%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 305..328 | ||||
Scr | NP_001368995.1 | Homeobox | 328..381 | CDD:395001 | 35/52 (67%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X14 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |