DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXD1 and unpg

DIOPT Version :9

Sequence 1:NP_078777.1 Gene:HOXD1 / 3231 HGNCID:5132 Length:328 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:345 Identity:93/345 - (26%)
Similarity:118/345 - (34%) Gaps:98/345 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    41 FPLGN------------------GDGAFVSCLPLAAARPSPSPPAAPARPSVPPPAAPQYAQCTL 87
            |||.|                  ..|.::...|  |..|:...|.|.|:|..|||..|.:|   |
  Fly    82 FPLYNPWLHGYFAQNHERLTHLIAGGCYLPSSP--AGHPAAQQPQAQAQPQPPPPHPPTHA---L 141

Human    88 EGAYEP--------------GAAPAAAAGGADYGFLGSGPAYDFPGVLGRAADDGGSHVHYATSA 138
            |....|              .||...|.....|..|......|:...|.         ||.....
  Fly   142 EKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLS---------VHARLQH 197

Human   139 VFSGGGSFLLSGQVDYAAFGEPGP----------------FPAC-------LKASADGHPGAFQT 180
            :.:.|...........|...||.|                .||.       .:.|.|.......|
  Fly   198 MAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLT 262

Human   181 ASP----------APGTYPKSVS-PASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAI-- 232
            .||          ..|.|..|.| ..|....|.|..|      .....||.::...:|.:|..  
  Fly   263 MSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHE------GGGMGGKDSQGNGSSSNSKSRR 321

Human   233 -RTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLHLNDTQVKIWFQNRRMKQKKREREGLLATA 296
             ||.|:::||.|||:|||..|||:...|.:||..|.|::.||||||||||.|. ||.:.||.:..
  Fly   322 RRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKW-KRVKAGLTSHG 385

Human   297 IPVAPLQLPLSGTTP-TKFI 315
                   |..:|||. ||.:
  Fly   386 -------LGRNGTTSGTKIV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXD1NP_078777.1 Antp-type hexapeptide 204..209 1/4 (25%)
Homeobox 233..285 CDD:278475 30/51 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..328 5/12 (42%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.