DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr12A and Lcp65Af

DIOPT Version :10

Sequence 1:NP_572896.1 Gene:Cpr12A / 32309 FlyBaseID:FBgn0030494 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster


Alignment Length:103 Identity:24/103 - (23%)
Similarity:46/103 - (44%) Gaps:14/103 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILFAIFLLSATLISAQQIKESAPSARLLDRFDNRYPDGSYEYRFELDDGTARYERGYFVKI-NDV 70
            :..|:|.|:  :...|.:|:.:....:           |:.|.:|..||::....|....: .|.
  Fly     6 VFVALFALA--VADVQILKQESDVGPV-----------SFNYGYETSDGSSAQAAGQLKNVGTDE 57

  Fly    71 KTLMVVGYYAYRMTDGRYITVFYNADQFGYRQNQSITP 108
            :.|.|.|.|::...||:..::.|.||:.||:...:..|
  Fly    58 EALNVKGTYSFVADDGQTYSIAYTADENGYQPQGAHLP 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr12ANP_572896.1 Chitin_bind_4 46..100 CDD:459790 15/54 (28%)
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790 15/54 (28%)

Return to query results.
Submit another query.