DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr12A and Lcp65Ag2

DIOPT Version :10

Sequence 1:NP_572896.1 Gene:Cpr12A / 32309 FlyBaseID:FBgn0030494 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_477272.1 Gene:Lcp65Ag2 / 38702 FlyBaseID:FBgn0020637 Length:105 Species:Drosophila melanogaster


Alignment Length:107 Identity:29/107 - (27%)
Similarity:48/107 - (44%) Gaps:22/107 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LFAIFLLSATLISAQQIKESAPSAR--LLDRFDNRYPDGSYEYRFELDDGTARYERGYFVKINDV 70
            |||:.|             :||:|.  .:.|.::.....|::|.:|..||.|....|   ::||:
  Fly    10 LFAVAL-------------AAPAAEEPTIVRSESDVGPESFKYDWETSDGQAAQAVG---QLNDI 58

  Fly    71 KT----LMVVGYYAYRMTDGRYITVFYNADQFGYRQNQSITP 108
            .|    :.|.|.|.:...||:...|.|.||:.|::...:..|
  Fly    59 GTENEAISVSGSYRFIADDGQTYQVNYIADKNGFQPQGAHLP 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr12ANP_572896.1 Chitin_bind_4 46..100 CDD:459790 18/57 (32%)
Lcp65Ag2NP_477272.1 Chitin_bind_4 37..92 CDD:459790 18/57 (32%)

Return to query results.
Submit another query.