DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr12A and Cpr49Ad

DIOPT Version :10

Sequence 1:NP_572896.1 Gene:Cpr12A / 32309 FlyBaseID:FBgn0030494 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster


Alignment Length:120 Identity:33/120 - (27%)
Similarity:53/120 - (44%) Gaps:29/120 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SAPSARLLDR-FDNRYPDGSYEYRFELDDGTARYERGYFVKI-NDVKTLMVVGYYAYRMTDGRYI 89
            :|..||:::: .|..|..|||.|.:|.::|....|||..|.| |..:...|.|.|::...:|..:
  Fly    63 AAAQARIVEQNNDVNYGAGSYSYNYETENGIHGEERGVPVNIGNQQQEEQVEGAYSFITPEGLRV 127

  Fly    90 TVFYNADQFGYRQNQSITPQEYPNLPRSIEVPMVSEASAASAASDGVSSSQFQSQ 144
            .|.|.||..|:|                   |:::        .|||:|:.:..|
  Fly   128 GVKYLADANGFR-------------------PVIT--------YDGVNSAFYAGQ 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr12ANP_572896.1 Chitin_bind_4 46..100 CDD:459790 18/54 (33%)
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:459790 18/54 (33%)

Return to query results.
Submit another query.