DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr12A and Cpr47Ea

DIOPT Version :10

Sequence 1:NP_572896.1 Gene:Cpr12A / 32309 FlyBaseID:FBgn0030494 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster


Alignment Length:120 Identity:35/120 - (29%)
Similarity:58/120 - (48%) Gaps:11/120 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ATSGSILFAIFLLSATLISAQQIKESAP--------SARLLDRFDNRYPDGSYEYRFELDDGTAR 58
            |::.:::.|:..||  .|.||..:...|        :|.:|.:..:..|||||:|.:|..:|...
  Fly     6 ASAAALVLALCCLS--FIQAQPQRGLPPPRGNSFDANAVILKQNFDLNPDGSYQYNYETSNGIRA 68

  Fly    59 YERGYFVKI-NDVKTLMVVGYYAYRMTDGRYITVFYNADQFGYRQNQSITPQEYP 112
            .|.||.... :.::..::.|.|:|...||...|:.|.||:.|||...:..|...|
  Fly    69 DEAGYLKNPGSQIEAQVMQGSYSYTGPDGVVYTITYIADENGYRAEGAHIPTPPP 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr12ANP_572896.1 Chitin_bind_4 46..100 CDD:459790 16/54 (30%)
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:459790 16/54 (30%)

Return to query results.
Submit another query.