DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr12A and Lcp1

DIOPT Version :9

Sequence 1:NP_572896.1 Gene:Cpr12A / 32309 FlyBaseID:FBgn0030494 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001260801.1 Gene:Lcp1 / 35817 FlyBaseID:FBgn0002531 Length:130 Species:Drosophila melanogaster


Alignment Length:42 Identity:11/42 - (26%)
Similarity:23/42 - (54%) Gaps:1/42 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GYYAYRMTDGRYITVFYNADQFGYRQNQSITPQEYPNLPRSI 118
            |.:.:...:|.::.|.|.|::.||:.:.:..|.. |.:|.:|
  Fly    70 GNFGWISPEGEHVEVKYVANENGYQPSGAWIPTP-PPIPEAI 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr12ANP_572896.1 Chitin_bind_4 46..100 CDD:278791 5/22 (23%)
Lcp1NP_001260801.1 Chitin_bind_4 46..93 CDD:278791 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439185
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.