DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15756 and CPR153

DIOPT Version :9

Sequence 1:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster
Sequence 2:XP_001238070.3 Gene:CPR153 / 4578106 VectorBaseID:AGAP009873 Length:334 Species:Anopheles gambiae


Alignment Length:121 Identity:28/121 - (23%)
Similarity:37/121 - (30%) Gaps:34/121 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 GSGMGMGTGIATGTGTKRNSISDPERNELPVEVEVNEAEDVDVDVDASDAGTELVPNAVNQVETE 254
            ||..|.|:|..:|.||.....|....|                   ..|||.|.:...|.|...:
Mosquito   202 GSRFGSGSGSGSGAGTASRFGSGSGNN-------------------GGDAGYEKIKEQVKQFNDD 247

  Fly   255 TEPSTLANDILATGAPADSHDDDH---------------DDDGDEDGDDDVDDDEG 295
            ......||:.....|.:...||.:               .|||.:...|.|.|:.|
Mosquito   248 GYYYKYANENNIEAAESGKIDDRNTENETLRAKGYYEYIGDDGQKYRVDYVADENG 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:278791
CPR153XP_001238070.3 Chitin_bind_4 249..304 CDD:278791 12/55 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.