DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15756 and CG15515

DIOPT Version :10

Sequence 1:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001263088.1 Gene:CG15515 / 43538 FlyBaseID:FBgn0039719 Length:123 Species:Drosophila melanogaster


Alignment Length:92 Identity:26/92 - (28%)
Similarity:38/92 - (41%) Gaps:5/92 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PRLV-DSFDQRSLDGQYEFRYQLDNGNTRYERAYWL-PVGKDLVLAKKGYY-SVPLPNDKYSTVF 154
            |.:| :.::|......|.|..:..||:.|.|....: |...|..|...|.| |.....|..:...
  Fly    30 PTIVSEYYNQAPTKEGYRFASEEPNGSKREEMGVIMNPGTPDEQLVVMGMYSSYDEKTDTETVTM 94

  Fly   155 YTADHRGYHVDMQTLSVEQPLLPRSLE 181
            ||||..||....|..:  :.|.|.:|:
  Fly    95 YTADKDGYKARYQIKN--RKLSPGALK 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:459790 17/55 (31%)
CG15515NP_001263088.1 None

Return to query results.
Submit another query.