DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15756 and Cpr78E

DIOPT Version :9

Sequence 1:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_649345.1 Gene:Cpr78E / 40408 FlyBaseID:FBgn0037114 Length:137 Species:Drosophila melanogaster


Alignment Length:87 Identity:27/87 - (31%)
Similarity:38/87 - (43%) Gaps:14/87 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 QPPVVVVQKPSHTETSPRLVDSFDQRSLDGQYEFRYQLDNGNTRYERAYWLPVG-KDLVLAKKGY 140
            ||||.:::. ||            ::..||.|.|.|..::|..|.|.|.....| ::..|...|.
  Fly    29 QPPVAILES-SH------------EKHEDGSYNFSYLGEDGTHRREEAVVRNQGTENEYLEISGS 80

  Fly   141 YSVPLPNDKYSTVFYTADHRGY 162
            ||....|.:..||.|.||..|:
  Fly    81 YSYFDANGQEVTVTYKADDHGF 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:278791 18/54 (33%)
Cpr78ENP_649345.1 Chitin_bind_4 47..102 CDD:278791 18/54 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.