DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15756 and Cpr78Ca

DIOPT Version :9

Sequence 1:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster


Alignment Length:172 Identity:36/172 - (20%)
Similarity:51/172 - (29%) Gaps:75/172 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MVTLAILLLLQPVDARWTRRPRRTTTPRSTTSITTANPDRHQHVHHWPPLVAPPPQPQPQPPVVV 82
            :|...:|:|:|.:..               |..|..:.||..:..:.||                
  Fly     7 IVVFLVLVLVQLIHC---------------TRFTAPSLDRTIYYRNTPP---------------- 40

  Fly    83 VQKPSHTETSPRLVDSFDQRSLDGQYEFRYQLDNGNTR----YERAYWLPVGKDLVLAKKGYYSV 143
                          |.|      |.|.|.:|..||.|.    .|..   .||....::.:|   :
  Fly    41 --------------DPF------GHYSFEFQTTNGITTKGAGNENG---AVGVVQFVSPEG---I 79

  Fly   144 PLPNDKYSTVFYTADHRGYHVDMQTLSVEQPLLP----RSLE 181
            |:      |..|.||..||    |......|.:|    |.||
  Fly    80 PV------TFSYVADANGY----QPTGDHIPAIPLHVIRQLE 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:278791 15/57 (26%)
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:278791 15/57 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.