DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15756 and Cpr65Aw

DIOPT Version :9

Sequence 1:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster


Alignment Length:83 Identity:21/83 - (25%)
Similarity:38/83 - (45%) Gaps:4/83 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 TETSPRLVDSFDQRSLDGQ-YEFRYQLDNGNTRYERAYWL-PVGKDLVLAKKGYYSVPLPNDKYS 151
            |:|:..|  .:|..::|.. |.|.::..:|.:|.|||... |...:..:|.:|......|:..:.
  Fly    23 TDTAQIL--RYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEEAIAIQGSVHWVGPDGIHY 85

  Fly   152 TVFYTADHRGYHVDMQTL 169
            .:.|.||..|:....:.|
  Fly    86 KLNYLADENGFQAQGEHL 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:278791 14/54 (26%)
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:278791 14/54 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.