DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15756 and frm

DIOPT Version :9

Sequence 1:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001137887.1 Gene:frm / 38624 FlyBaseID:FBgn0035612 Length:1180 Species:Drosophila melanogaster


Alignment Length:303 Identity:63/303 - (20%)
Similarity:101/303 - (33%) Gaps:106/303 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TTPRSTTSITTANPDRHQHVHHWPPLVAP------PPQPQPQPPVVVVQ-----KPS-------- 87
            :|||....:.|..|....|....|.:|.|      |.:|..:||.|.|:     :||        
  Fly   822 STPRPFEKVVTKLPQIQYHTPQVPTVVVPKQPVTVPYKPVTRPPTVYVEPKVTPRPSPPLHVPSI 886

  Fly    88 ----------HTETSPRLVDSFDQRSLDGQY------EFRYQLD--NGNTRY------------- 121
                      .|.:|...:.|....:....|      :|..|..  ||...:             
  Fly   887 SDQSCVCNADKTHSSKSTLTSTTTTTTTNSYPNPASVDFNKQFSGFNGQANFGSIINAMSLTQLP 951

  Fly   122 -------ERAYWLP--VGKDLVLAKKGYYSVPLPNDKYSTVFYTADHRGYHVDMQTLSVEQPLLP 177
                   :.|::.|  :.|..|:|....  |.||.:.||.....:.::..::|...|.|:     
  Fly   952 VIPQAPGQPAFYPPDKIPKGAVIALMPV--VILPQEYYSNCEENSINQLTNIDSFPLGVQ----- 1009

  Fly   178 RSLEVPGVERDVGSGMGMGTGIATGTGTKRNSISD-------PER---------NELPVEVEVNE 226
                 |||...:.|       :.||:..|...:..       |.|         .|.|:|.:.:|
  Fly  1010 -----PGVSFSLHS-------VLTGSAPKDQCMCPCSCTQNLPNRLHKKREATDTEAPLEEKASE 1062

  Fly   227 -----AEDVDVDVDASDAGTELVPNAVNQVETETEPSTLANDI 264
                 :|:|...|       |.||.|..:|:|..||...|:::
  Fly  1063 PVAAASEEVKTLV-------EPVPAAAEEVKTLVEPVPAASEV 1098

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:278791 15/83 (18%)
frmNP_001137887.1 Chitin_bind_4 54..102 CDD:278791
MttA_Hcf106 <1046..1128 CDD:294511 16/60 (27%)
L12 1051..1159 CDD:273301 16/55 (29%)
HHH_5 1092..>1168 CDD:304555 1/7 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.