DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15756 and CG1136

DIOPT Version :9

Sequence 1:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_647853.1 Gene:CG1136 / 38479 FlyBaseID:FBgn0035490 Length:458 Species:Drosophila melanogaster


Alignment Length:201 Identity:48/201 - (23%)
Similarity:59/201 - (29%) Gaps:62/201 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 STTSITTANPDRHQHVHHWPPLVAP----PPQPQPQPPVVVVQKPSHTETSPRLVDSFDQRSLDG 106
            |..|.|||.|   ..:...|||.|.    .|:|.|.|..:|...|:....:.....|..|.....
  Fly   249 SVISSTTARP---PSLDMLPPLSAHRRRLRPRPTPAPVAIVSSTPAPISGADLYGYSTPQPFAAP 310

  Fly   107 QYEFRYQLDNGNTRYERAYWLPVGKDLVLAKKGYYSVPLPNDKYSTVFYTADHRGYHVDMQTLSV 171
            .|:|.....:..|.|                 |||  |.|...              ||:.  |:
  Fly   311 AYQFAPPATSSTTGY-----------------GYY--PPPQSP--------------VDVN--SL 340

  Fly   172 EQPLLP-----------RSLEVPGVERDVGSGMGMGTGIATGTGTKRNSISDPERNELPVEVEVN 225
            |..|||           |...|.|...|     |:......|.|..||..    |..||.:....
  Fly   341 EAALLPPLPSSSYRRRLRPRPVQGNHLD-----GLAASEYDGVGVTRNGF----RYVLPKQYHEE 396

  Fly   226 EAEDVD 231
            |....|
  Fly   397 ETNPSD 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:278791 9/53 (17%)
CG1136NP_647853.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.