DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15756 and CG11816

DIOPT Version :9

Sequence 1:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001259515.1 Gene:CG11816 / 32310 FlyBaseID:FBgn0030495 Length:362 Species:Drosophila melanogaster


Alignment Length:203 Identity:55/203 - (27%)
Similarity:73/203 - (35%) Gaps:69/203 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PVDARWTRRPRRTT--TPRSTTSITTANPDRHQ----HVHHWP---------------------- 65
            |:....|.....||  |.|:|:|.|:..|...|    ....||                      
  Fly   168 PLSTTTTTEATTTTARTTRATSSTTSITPKPTQIGTPIEQIWPLYEDQLVVFPQMDFEEENLDYF 232

  Fly    66 --------------PLVAPPPQPQPQP-PVVVVQK-----PSHTETSPRLVDSFDQRSLDGQYEF 110
                          ||....|...|.| |:.|||.     |:.||                  |:
  Fly   233 FDEVPPSTSSTTGRPLTTSHPTGTPTPTPIYVVQNYHVIHPNGTE------------------EY 279

  Fly   111 RYQLDNGNTRYERAYWLPVGKDLVLAKKGYYSVPLPNDK--YSTVFYTADHRGYHVDMQTLSVEQ 173
            :..:.||...|::.|...||..|:..::||.|||:|..|  ..|.:|.||.|||:|....|...|
  Fly   280 KLVMSNGLVNYKKLYSKKVGDRLINVQEGYNSVPIPGPKNQIQTQYYIADERGYNVYRIELHYHQ 344

  Fly   174 P-LLPRSL 180
            | |||:.|
  Fly   345 PGLLPKHL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:278791 20/55 (36%)
CG11816NP_001259515.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016689
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.