DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15756 and CPR106

DIOPT Version :9

Sequence 1:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster
Sequence 2:XP_316152.4 Gene:CPR106 / 1276767 VectorBaseID:AGAP006095 Length:150 Species:Anopheles gambiae


Alignment Length:115 Identity:27/115 - (23%)
Similarity:40/115 - (34%) Gaps:27/115 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LVAPP-------PQPQPQPPVVVVQKPSHTETSPRLVDSFDQRSLDGQYEFRYQLDNGNTRYERA 124
            |.|||       ||..|.....||       ...::::.      .|.|.:.|:..||....:.:
Mosquito    17 LAAPPAPLTKRSPQGGPDSEATVV-------AQDQIINE------GGSYAYNYETSNGIKARQTS 68

  Fly   125 YWLPVGKDLVLAKKGYYSVPLPNDKYSTVFYTADHRGYHVDMQTLSVEQP 174
                   |..::..|.||...|:....:|.|.||..|:......|..|.|
Mosquito    69 -------DNGVSANGEYSFLAPDGTSYSVVYVADENGFQPQGAHLPTEPP 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:278791 13/53 (25%)
CPR106XP_316152.4 Chitin_bind_4 52..99 CDD:278791 13/53 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.