DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15754 and Lcp65Ag3

DIOPT Version :9

Sequence 1:NP_572894.1 Gene:CG15754 / 32307 FlyBaseID:FBgn0030492 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster


Alignment Length:102 Identity:26/102 - (25%)
Similarity:34/102 - (33%) Gaps:29/102 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 PALPQPGGVLEELAGG----QVDEELEDYNAWRDNFYELNEDGSYIFGYSIPHGIRRWEKGYYSE 218
            ||..:|..|..|...|    :.|.|..|..| .....:||:.|:                     
  Fly    18 PAAEEPTIVRSESDVGPESFKYDWETSDGQA-AQAVGQLNDIGT--------------------- 60

  Fly   219 EQHGRVVEGFYVQPRHDSQGLRYELRCYRADSEGYQP 255
            |.....|.|.|.....|.|  .|::. |.||..|:||
  Fly    61 ENEAISVSGSYRFIADDGQ--TYQVN-YIADKNGFQP 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15754NP_572894.1 None
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:278791 17/79 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.