powered by:
Protein Alignment CG15754 and Lcp9
DIOPT Version :9
Sequence 1: | NP_572894.1 |
Gene: | CG15754 / 32307 |
FlyBaseID: | FBgn0030492 |
Length: | 281 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_523854.1 |
Gene: | Lcp9 / 37963 |
FlyBaseID: | FBgn0025578 |
Length: | 92 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 19/72 - (26%) |
Similarity: | 30/72 - (41%) |
Gaps: | 10/72 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 188 NFYELNEDGSYIFGYSIPHGIRRWEKGYYSEEQHGRVVEGFYVQPRHDSQGLRYELRCYRADSEG 252
|..:.| :.|.:.:.||..:.|...|..:. ||.|.|.....:.:.::. .|.||..|
Fly 30 NLLDFN------YAYELSNHIRAVQTGALKEHDNW-VVSGEYEYVAPNGKTVKV---VYTADETG 84
Fly 253 YQPRPVE 259
|.|:.||
Fly 85 YHPKVVE 91
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15754 | NP_572894.1 |
None |
Lcp9 | NP_523854.1 |
Chitin_bind_4 |
34..85 |
CDD:278791 |
13/60 (22%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.