DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15754 and Cpr49Ag

DIOPT Version :9

Sequence 1:NP_572894.1 Gene:CG15754 / 32307 FlyBaseID:FBgn0030492 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_610776.1 Gene:Cpr49Ag / 36353 FlyBaseID:FBgn0033730 Length:134 Species:Drosophila melanogaster


Alignment Length:80 Identity:25/80 - (31%)
Similarity:32/80 - (40%) Gaps:20/80 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 NEDGSYIFGYSIPHGIRRWEKGYY-------SEEQHGRVVE----------GFYVQPRHDSQGLR 240
            |.|||:...|...:|||....||.       :|...|:|::          |.|  ...|..|..
  Fly    48 NADGSFNSSYETSNGIRVENIGYLKKIIVPKTETSDGQVIDEHEELVLVQTGSY--SYSDPDGNL 110

  Fly   241 YELRCYRADSEGYQP 255
            ..|| |.||..|:||
  Fly   111 ITLR-YVADENGFQP 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15754NP_572894.1 None
Cpr49AgNP_610776.1 Chitin_bind_4 53..122 CDD:278791 18/71 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.