DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15754 and Cpr47Ea

DIOPT Version :9

Sequence 1:NP_572894.1 Gene:CG15754 / 32307 FlyBaseID:FBgn0030492 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster


Alignment Length:127 Identity:43/127 - (33%)
Similarity:55/127 - (43%) Gaps:25/127 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 QPQPLPPALPQPGGVLEELAGGQVDEELEDYNA--WRDNFYELNEDGSYIFGYSIPHGIRRWEKG 214
            |||   ..||.|.|            ...|.||  .:.|| :||.||||.:.|...:|||..|.|
  Fly    24 QPQ---RGLPPPRG------------NSFDANAVILKQNF-DLNPDGSYQYNYETSNGIRADEAG 72

  Fly   215 YY---SEEQHGRVVEGFYVQPRHDSQGLRYELRCYRADSEGYQPRPVEFLRTPPIVRRDAIP 273
            |.   ..:...:|::|.|.....|  |:.|.: .|.||..||:..... :.|||.||..|.|
  Fly    73 YLKNPGSQIEAQVMQGSYSYTGPD--GVVYTI-TYIADENGYRAEGAH-IPTPPPVRAAAAP 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15754NP_572894.1 None
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:278791 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016696
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.