DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neto and NETO2

DIOPT Version :10

Sequence 1:NP_001285211.1 Gene:Neto / 32303 FlyBaseID:FBgn0265416 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_060562.3 Gene:NETO2 / 81831 HGNCID:14644 Length:525 Species:Homo sapiens


Alignment Length:36 Identity:13/36 - (36%)
Similarity:16/36 - (44%) Gaps:12/36 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 DFCHNAI-LFSNLIIAIHRMFVFFFKKHTDIAFEKP 176
            |.|..|. :.|||  .:||      :.||.   |||
Human   526 DHCGKAFSIGSNL--NVHR------RIHTG---EKP 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NetoNP_001285211.1 CUB 151..252 CDD:238001 10/26 (38%)
CUB <298..384 CDD:238001
LDLa 392..426 CDD:238060
NETO2NP_060562.3 CUB 45..158 CDD:238001
CUB <205..291 CDD:238001
LDLa 297..331 CDD:238060
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.