DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neto and neto1

DIOPT Version :9

Sequence 1:NP_001285211.1 Gene:Neto / 32303 FlyBaseID:FBgn0265416 Length:822 Species:Drosophila melanogaster
Sequence 2:XP_017214681.1 Gene:neto1 / 556922 ZFINID:ZDB-GENE-070912-592 Length:93 Species:Danio rerio


Alignment Length:70 Identity:20/70 - (28%)
Similarity:31/70 - (44%) Gaps:5/70 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 PPRAGRSERQAEEDQVDRCRLFVEGDPTKNELY-SPEYPNLYPKNINCTRVITAPKGQIIRL--D 182
            ||:....:..:....|..|..:::  .|...|: ||.||..||.:..|..:|.|...|.|.|  |
Zfish    26 PPKKAIVKNNSGVTPVGLCGSWIK--ETNGGLFTSPNYPEKYPPDRECIYIIEAAPRQCIDLYFD 88

  Fly   183 FRNSF 187
            ::..|
Zfish    89 YKYKF 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NetoNP_001285211.1 CUB 151..252 CDD:238001 15/40 (38%)
CUB <298..384 CDD:238001
LDLa 392..426 CDD:238060
neto1XP_017214681.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I6730
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002629
OrthoInspector 1 1.000 - - otm25574
orthoMCL 1 0.900 - - OOG6_106092
Panther 1 1.100 - - O PTHR24251
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1989
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.