powered by:
Protein Alignment Neto and neto1
DIOPT Version :9
Sequence 1: | NP_001285211.1 |
Gene: | Neto / 32303 |
FlyBaseID: | FBgn0265416 |
Length: | 822 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017214681.1 |
Gene: | neto1 / 556922 |
ZFINID: | ZDB-GENE-070912-592 |
Length: | 93 |
Species: | Danio rerio |
Alignment Length: | 70 |
Identity: | 20/70 - (28%) |
Similarity: | 31/70 - (44%) |
Gaps: | 5/70 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 121 PPRAGRSERQAEEDQVDRCRLFVEGDPTKNELY-SPEYPNLYPKNINCTRVITAPKGQIIRL--D 182
||:....:..:....|..|..::: .|...|: ||.||..||.:..|..:|.|...|.|.| |
Zfish 26 PPKKAIVKNNSGVTPVGLCGSWIK--ETNGGLFTSPNYPEKYPPDRECIYIIEAAPRQCIDLYFD 88
Fly 183 FRNSF 187
::..|
Zfish 89 YKYKF 93
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Neto | NP_001285211.1 |
CUB |
151..252 |
CDD:238001 |
15/40 (38%) |
CUB |
<298..384 |
CDD:238001 |
|
LDLa |
392..426 |
CDD:238060 |
|
neto1 | XP_017214681.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
103 |
1.000 |
Domainoid score |
I6730 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0002629 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm25574 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_106092 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR24251 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1989 |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
8 | 7.910 |
|
Return to query results.
Submit another query.