DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neto and Cdcp2

DIOPT Version :9

Sequence 1:NP_001285211.1 Gene:Neto / 32303 FlyBaseID:FBgn0265416 Length:822 Species:Drosophila melanogaster
Sequence 2:XP_038967409.1 Gene:Cdcp2 / 298306 RGDID:1563467 Length:566 Species:Rattus norvegicus


Alignment Length:254 Identity:71/254 - (27%)
Similarity:111/254 - (43%) Gaps:52/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 SPEYPNLYPKNINCTRVITAPKGQIIRLDFRNSFNIEAKEGCKFDFLEIRDG-QYGFSTLIGKFC 217
            ||.:|:|||.|..|:.:|...:|..:.|.| ::|::|..:.|.||||||.:| ......|:|:||
  Rat    69 SPNFPSLYPYNTECSWLIVVAEGSSVLLTF-HTFDLEYHDTCGFDFLEIYNGASRDKGNLLGRFC 132

  Fly   218 GTDFPPEITSKERYLWLHFHSDETIEYTGFSAVYEYLDRSRDAPSTDLNCTIDKGGFEGFINSTD 282
            |...||..||....:.:.||||:.:...||||.|:     :|.      |.....|..|.::|.:
  Rat   133 GQAPPPPFTSSWHVMSVVFHSDKHVASRGFSAGYQ-----KDV------CGGVLTGLSGILSSPE 186

  Fly   283 VPAEIWEQVNRNKIALDCIWRIQVKENWKIFLKFLDFKLSKPNDCQTNFLDIFPEQTVM----PL 343
            .|       |.....::|.|.|:......:.|.|:||::....:|      ::...||:    |.
  Rat   187 YP-------NNYPNNVECHWLIRASGPATVKLVFVDFQVEGSEEC------MYDHVTVLGAPGPA 238

  Fly   344 RVKNFCGSAGESITAESNILHLRFYADQTAINSTFGI----------------LFTAFR 386
            ...::|||     |....::.|. :..|....|.|.|                :|||.|
  Rat   239 HGHHYCGS-----TRPPTLVSLG-HELQVVFKSDFNIGGRGFKAHYFSGECQEVFTAVR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NetoNP_001285211.1 CUB 151..252 CDD:238001 39/98 (40%)
CUB <298..384 CDD:238001 21/105 (20%)
LDLa 392..426 CDD:238060
Cdcp2XP_038967409.1 CUB 56..167 CDD:238001 39/98 (40%)
CUB 171..280 CDD:238001 26/127 (20%)
CUB 283..396 CDD:238001 4/9 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.