DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neto and mfrp

DIOPT Version :9

Sequence 1:NP_001285211.1 Gene:Neto / 32303 FlyBaseID:FBgn0265416 Length:822 Species:Drosophila melanogaster
Sequence 2:XP_009289590.1 Gene:mfrp / 101885305 ZFINID:ZDB-GENE-160728-150 Length:572 Species:Danio rerio


Alignment Length:312 Identity:78/312 - (25%)
Similarity:135/312 - (43%) Gaps:50/312 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 LYSPEYPNLYPKNINCTRVITAPKGQIIRLDFRNSFNIEAKEGCKFDFLEIRDGQYGFSTLIGKF 216
            |.||.:|.:||.:.:|..||......::::.. :|..||....|.||:||:|: :...::...:|
Zfish   149 LSSPNHPGVYPPDSHCVWVIRVSPPSLVQIQV-SSLAIEGPSPCLFDWLEVRE-ETEKTSAATRF 211

  Fly   217 CGTDFPPEITSKERYLWLHFHSDETIEYTGFSAVYEYL-----DRSRDA---------------- 260
            ||...||.:.:....:.:.||||.:|..|||.|.|..:     ..||:.                
Zfish   212 CGNVAPPTLNTNSSTVLVSFHSDGSIGGTGFIAQYHSILPGQRSCSREEFMCDSGHCLLPVFICD 276

  Fly   261 -------PSTDLNCT----IDKG---GFEGFINSTDVPAEIWEQVNRNKIALDCIWRIQVKENWK 311
                   .|.:|||:    :..|   |..|.::|.:.|.....|..       |.|:|.|::...
Zfish   277 GQPNCQDHSDELNCSHKHRVCGGQITGEYGSLSSPNHPKPYPHQQM-------CTWQISVEDGQV 334

  Fly   312 IFLKFLDFKLSKPNDCQTNFLDIFP-EQTVMPLRVKNFCGSA-GESITAESNILHLRFYADQTAI 374
            |.|.|.:|.|...:.|:.::::::. .:|.:    ..:|||| ...:|:...:|.:.|.||:...
Zfish   335 IRLSFQNFSLEAQDVCKFDYVEVYDGAETAL----GRYCGSALPPDLTSSGPVLTVVFVADEGVA 395

  Fly   375 NSTFGILFTAFRERGAACTEDEYDCEDATCISKDLKCNNLDNCKFRWDEEGC 426
            :|.|...|.|.......|:..::.|....|:.:|..|:...:|....||..|
Zfish   396 DSGFYASFQAISLSERTCSPAQFACPTGECLHQDWLCDGWSDCADGADEHHC 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NetoNP_001285211.1 CUB 151..252 CDD:238001 32/99 (32%)
CUB <298..384 CDD:238001 23/87 (26%)
LDLa 392..426 CDD:238060 8/33 (24%)
mfrpXP_009289590.1 CUB 138..248 CDD:238001 33/100 (33%)
LDLa 256..290 CDD:238060 4/33 (12%)
CUB 297..405 CDD:238001 29/118 (25%)
LDLa 413..447 CDD:238060 8/33 (24%)
Fz 459..563 CDD:279700
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.