DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34324 and CG34220

DIOPT Version :10

Sequence 1:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001097253.1 Gene:CG34220 / 5740467 FlyBaseID:FBgn0085249 Length:726 Species:Drosophila melanogaster


Alignment Length:345 Identity:115/345 - (33%)
Similarity:126/345 - (36%) Gaps:119/345 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PPRADTP--PCTP---PPDPC--TTTTCPPPPPC---------------------------TTTT 56
            ||....|  |.||   ||.||  ..||.|||.||                           ||||
  Fly   398 PPSPSEPNEPSTPSPAPPSPCEPNDTTTPPPSPCETTTTITTTTTTTTTTTTTTTTTTTTTTTTT 462

  Fly    57 CPPPEPPPCTTTTCPPPEPPPC----TTTTCPPPPPPCITTTCPPPPPPPPPPPPPPC----TRT 113
            ........|.|||...||.|||    .:|..|.||.|    :.|..|..|.|.||.||    |.|
  Fly   463 TATTTITSCETTTTEAPEQPPCEPNEPSTPTPSPPSP----SEPNEPSTPTPSPPSPCEPNETTT 523

  Fly   114 PP--PC--------------------------------------------TRTPPPCTRTPPPCT 132
            ||  ||                                            |.|....|.|..|.|
  Fly   524 PPPSPCETTTSTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCIPTT 588

  Fly   133 RT----PPPC----TRTPPPCTRTPPCTTTPPCTPPCTTTKPCTTTVCTTPKSDNAG-------P 182
            .|    .|||    |.|||||.|.   |||.|  |||..|   ||..|.| |||.:|       |
  Fly   589 TTTIPQQPPCEPKTTPTPPPCARR---TTTTP--PPCEET---TTPACDT-KSDQSGLAQSIPKP 644

  Fly   183 IVDGNEEQPDIDNPVAIAQVLISRHDCRGQEDGTFLADVRHCRRYYVCNRQRSKRQNCPNGYWFD 247
            |.|...:  .|.|..|...:..|.. |.|:.||:.:.|..||||||.|...|...:.|..|.|:|
  Fly   645 IKDLFAD--SITNTKATIPIGSSAM-CAGRADGSIVQDPNHCRRYYECRAGRRLLRKCRAGLWYD 706

  Fly   248 RELKACRLASTVNNCDARRN 267
            .|...|...|.|.||.|:||
  Fly   707 SEAGECLPRSQVLNCPAQRN 726

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34324NP_001096972.1 CBM_14 209..262 CDD:426342 21/52 (40%)
CG34220NP_001097253.1 CBM_14 668..721 CDD:426342 21/52 (40%)

Return to query results.
Submit another query.