DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34324 and Mur89F

DIOPT Version :9

Sequence 1:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001262662.1 Gene:Mur89F / 42080 FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster


Alignment Length:330 Identity:86/330 - (26%)
Similarity:111/330 - (33%) Gaps:111/330 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PPRADTPPCTPP-------PDPCTTTTCPPPPPCTT--TTCPPPEPPPCTT----TTCPPPEPP- 76
            ||...||..:.|       |...|:|:.|..||.|.  .|..|....|.|.    ||.|..:.| 
  Fly  1266 PPTTSTPTTSRPTTASTSRPSDQTSTSRPTGPPTTARPVTARPTTSSPTTASSSQTTSPVTQAPN 1330

  Fly    77 --------------------------------------------------------PCTT-TTCP 84
                                                                    .|:| |...
  Fly  1331 TDGKCRSEGFMADPNNCSKFYRCVRNNKGGFTSIPFQCGAGTVWDQDLQTCNHNFNNCSTGTEST 1395

  Fly    85 PPPPPC----------ITTTCPPPPPPPPPPPPPPCTRTPPPCTRTPPPCTRT---PPPCTRTPP 136
            .|.|||          .|::...|||.....||...|..||..|...||.|.|   |...||.||
  Fly  1396 TPKPPCEPATNGTTATSTSSTTTPPPTTTDLPPTSTTGLPPTTTTELPPTTTTDLPPTTTTRLPP 1460

  Fly   137 PCTRTPPPCTRT--PPCTTTPPCTPPCTTT---KPCTTTVCTTPKSDNAGPIVDGNEEQPDIDNP 196
            ..|.:.||.|.|  ||.|||.  ..|.|||   :..|:||.|:|:|....|.....:..|     
  Fly  1461 TTTTSLPPTTTTGLPPTTTTG--AQPTTTTLSSETETSTVTTSPESTTQPPSTTTMKPLP----- 1518

  Fly   197 VAIAQVLISRHDCRGQEDGTFLADVRHCRRYYVC-NRQRSKRQ---NCPNGYWFDRELKACRLAS 257
                    :..:|.|:   .::||...||:||.| |...|.|:   .||.|..::.|::.|....
  Fly  1519 --------AGTECTGE---GYMADPEDCRKYYRCINAGASYRKYNFTCPKGTGWNEEVQTCDYVE 1572

  Fly   258 TVNNC 262
            .:..|
  Fly  1573 NIPRC 1577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34324NP_001096972.1 CBM_14 209..262 CDD:279884 17/56 (30%)
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884
CBM_14 200..250 CDD:279884
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884
CBM_14 1206..1261 CDD:279884
CBM_14 1336..1388 CDD:279884 0/51 (0%)
CBM_14 1523..1577 CDD:279884 17/56 (30%)
VAD1-2 <1599..>1656 CDD:291956
CBM_14 1809..1861 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.