DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG34324 and Gasp

DIOPT Version :9

Sequence 1:	NP_001096972.1	Gene:	CG34324 / 32302	FlyBaseID:	FBgn0085353	Length:	267	Species:	Drosophila melanogaster
Sequence 2:	NP_649611.2	Gene:	Gasp / 40745	FlyBaseID:	FBgn0026077	Length:	258	Species:	Drosophila melanogaster

Alignment Length:	71	Identity:	18/71 - (25%)
Similarity:	29/71 - (40%)	Gaps:	4/71 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   197 VAIAQVLISRHDCRGQEDGTFLADVRHCRRYYVCNRQRSKRQNCPNGYWFDRELKACRLASTVNN 261
            ||:....:::...:..:|..|......|.:|:.|:...|:.:.|.||..||    |........|
  Fly     9 VALFGAAVAQSSFKCPDDFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFD----ATDSKYLTEN 69

  Fly   262 CDARRN 267
            ||...|
  Fly    70 CDYLHN 75

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG34324	NP_001096972.1	CBM_14	209..262	CDD:279884	12/52 (23%)
Gasp	NP_649611.2	ChtBD2	21..72	CDD:214696	14/54 (26%)
		CBM_14	97..144	CDD:366726
		CBM_14	170..218	CDD:366726
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR23301
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100