DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34324 and CG17145

DIOPT Version :10

Sequence 1:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_649192.2 Gene:CG17145 / 40215 FlyBaseID:FBgn0036953 Length:334 Species:Drosophila melanogaster


Alignment Length:45 Identity:14/45 - (31%)
Similarity:20/45 - (44%) Gaps:5/45 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 SVYLLSLLVVYAMMYNNCRYRYSLNVLHYELYCQTSAVVNLPPPK 220
            ||.|:.|||.:.....:...|..|.:.|     .:.||.:||..|
  Fly    66 SVALVLLLVAFFSSKYSVEGRSLLTMTH-----SSQAVRDLPVSK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34324NP_001096972.1 CBM_14 209..262 CDD:426342 5/12 (42%)
CG17145NP_649192.2 CBM_14 91..142 CDD:426342 6/20 (30%)
CBM_14 278..327 CDD:426342
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.