DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34324 and CG6996

DIOPT Version :9

Sequence 1:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster


Alignment Length:134 Identity:33/134 - (24%)
Similarity:43/134 - (32%) Gaps:30/134 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 CTRTPPCTTTPP--CTPP--CTTTKPC-----TTTVCTTPKSDNAGP---IVD---GNEEQPDID 194
            |..:.||...|.  ...|  |.....|     |..||.|..:.|:|.   |.|   .|:..||  
  Fly    81 CLSSDPCAALPTGFAADPYSCNGYYYCKDGKGTHGVCNTGMNFNSGTQDCIRDFPCSNKMDPD-- 143

  Fly   195 NPVAIAQVLISRHDCRGQEDGTFLADVRHCRRYYVCNRQRSKRQNCPNGYWFDRELKACRLASTV 259
                        ..|....||.|:.|..:|..|.:|...:.....||..::|......|.....|
  Fly   144 ------------SYCNILPDGVFVKDTDNCNGYQLCWDGQVINGTCPGTFYFKASTAQCDYPQNV 196

  Fly   260 NNCD 263
             .||
  Fly   197 -ECD 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34324NP_001096972.1 CBM_14 209..262 CDD:279884 13/52 (25%)
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884
ChtBD2 85..130 CDD:214696 12/44 (27%)
CBM_14 146..196 CDD:279884 12/49 (24%)
CBM_14 273..322 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.