DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34324 and CG7290

DIOPT Version :9

Sequence 1:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001262093.1 Gene:CG7290 / 40211 FlyBaseID:FBgn0036949 Length:419 Species:Drosophila melanogaster


Alignment Length:219 Identity:48/219 - (21%)
Similarity:66/219 - (30%) Gaps:98/219 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 CTRT-PPPCTRTPPPC---------TRTPPCTTTPPCTPPCTTTKPC--------TTTVC----T 173
            ||.| |..||....||         ..:..|.....|.........|        ||..|    .
  Fly    76 CTGTVPSTCTSNSDPCLGKAVGSFAASSSSCGGYYYCGASGAVRGNCPAGENFNPTTMACVYKNN 140

  Fly   174 TPKSDNAGPIVDGNEEQPDIDNPVAIAQVLI----------SRHDCRGQ-------------EDG 215
            .|.|::||   ||        :.|::|..|.          |..||.|.             |||
  Fly   141 YPCSESAG---DG--------STVSVALNLCNLVKNGFYFGSPSDCSGWNFCQDNVLHSGSCEDG 194

  Fly   216 ---------------TFLADVRH------------------------CRRYYVCNRQRSKRQNCP 241
                           :..|.|.:                        |.:||:|:....:...||
  Fly   195 LVFNVQASNCGYKMASSCAQVTNDPSLTGVSAPTTCSSSGATIAATACNQYYLCSAGNYQLMTCP 259

  Fly   242 NGYWFDRELKAC--RLASTVNNCD 263
            :||::|...|||  |:.:. |:||
  Fly   260 SGYYYDTISKACVTRMEAR-NDCD 282

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG34324NP_001096972.1 CBM_14 209..262 CDD:279884 21/106 (20%)