DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34324 and CG7298

DIOPT Version :10

Sequence 1:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_649187.3 Gene:CG7298 / 40210 FlyBaseID:FBgn0036948 Length:369 Species:Drosophila melanogaster


Alignment Length:106 Identity:26/106 - (24%)
Similarity:41/106 - (38%) Gaps:22/106 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 TTVCTTPKSDNAGPIVDGNEEQPDIDNPVAIAQVLISRHDCRGQEDGTFLADVRHCRRYYVCNRQ 233
            |.:|..........|::||.      |..|:         |...:.||.|..:..|:.||||...
  Fly     9 TILCLMGGQALGDAILEGNY------NVTAV---------CTAVKVGTQLGSIESCQTYYVCQST 58

  Fly   234 RSKRQNCPNGYWFDRELKACRLASTV-------NNCDARRN 267
            ...:.:|.:||.:|.:..:|..:|.|       |.|..:.|
  Fly    59 GPVQSSCQSGYSYDYKRSSCYPSSEVDCYWGVENPCAGKNN 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34324NP_001096972.1 CBM_14 209..262 CDD:426342 17/59 (29%)
CG7298NP_649187.3 ChtBD2 <239..274 CDD:214696
ChtBD2 286..334 CDD:214696
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.