DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34324 and CG10154

DIOPT Version :9

Sequence 1:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster


Alignment Length:118 Identity:32/118 - (27%)
Similarity:43/118 - (36%) Gaps:17/118 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 CTPPCTT---TKPCTTTVCTTPKSDNAG-PIV----DG---NEEQPDIDNPVAIAQVLISRHDCR 210
            |.|.|.:   :..|....||.......| |::    ||   |......|.|..:..|   .:||.
  Fly   126 CLPTCESFRLSSFCYDNTCTKYVLCYYGKPVLRQCHDGLQYNNATDRCDFPEYVDCV---ANDCS 187

  Fly   211 G---QEDGTFLADVRHCRRYYVCNRQRSKRQNCPNGYWFDRELKACRLASTVN 260
            .   .||..:|.....|.:||||:......|.|..|..::...|.|..|..||
  Fly   188 ATFQPEDIIYLGSKASCSKYYVCSNGHPWEQQCAPGLAYNPSCKCCDFAKNVN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34324NP_001096972.1 CBM_14 209..262 CDD:279884 17/55 (31%)
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 11/49 (22%)
CBM_14 197..239 CDD:279884 12/41 (29%)
ChtBD2 263..311 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.