| Sequence 1: | NP_001096972.1 | Gene: | CG34324 / 32302 | FlyBaseID: | FBgn0085353 | Length: | 267 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_648528.1 | Gene: | CG17826 / 39354 | FlyBaseID: | FBgn0036227 | Length: | 751 | Species: | Drosophila melanogaster |
| Alignment Length: | 234 | Identity: | 45/234 - (19%) |
|---|---|---|---|
| Similarity: | 62/234 - (26%) | Gaps: | 82/234 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 75 PPPCTTTTCPPPPPPC-----------ITTTCPPPPPPPPPPPPPPCTRTPPPCTRTPPPCTR-T 127
Fly 128 PPPCTRTPPPCTR-----TPPPCTRTPPCTTTPPCTPPCT------------------------- 162
Fly 163 -TTKP---CTT-TVCT----TPKSDNAGPIVDGNEEQPDIDNPVAIAQVLISRHDCRGQ----ED 214
Fly 215 GTFLADVRHCRRYYVCNRQRSKRQNCPNGYWFDRELKAC 253 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG34324 | NP_001096972.1 | CBM_14 | 209..262 | CDD:279884 | 13/49 (27%) |
| CG17826 | NP_648528.1 | CBM_14 | 36..74 | CDD:279884 | |
| ChtBD2 | <89..124 | CDD:214696 | 7/50 (14%) | ||
| CBM_14 | 145..184 | CDD:279884 | 4/38 (11%) | ||
| CBM_14 | 251..290 | CDD:279884 | 9/35 (26%) | ||
| CBM_14 | 357..396 | CDD:279884 | |||
| CBM_14 | 463..502 | CDD:279884 | |||
| CBM_14 | 563..610 | CDD:279884 | |||
| CBM_14 | 621..670 | CDD:279884 | |||
| CBM_14 | 697..749 | CDD:279884 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR23301 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||