DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34324 and CG7252

DIOPT Version :9

Sequence 1:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster


Alignment Length:151 Identity:34/151 - (22%)
Similarity:46/151 - (30%) Gaps:45/151 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 CTRTPPPCTRTP---------PCTTTPPCTPPCTTTKPCTTT----------------VC----T 173
            |..|...|...|         .|.....|...|...:.|...                ||    |
  Fly   336 CNTTSTVCQNQPEGELFPVEGKCNMFYKCNFNCAVEQYCPNNLVYNPNTEECEYPQDYVCPWEYT 400

  Fly   174 TPKSDNAGPIVDGNEEQPDIDNPVAIAQVLISRHDCRGQEDGTFLADVRHCRRYYVCNRQRSKRQ 238
            .|...||||            :.:|..    |...|.||.:||:|....:|..|.||..:.....
  Fly   401 PPSGPNAGP------------SGIACE----SNGRCMGQREGTYLKSTTNCSNYVVCQCECEVEM 449

  Fly   239 NCPNGYWFDRELKACRLASTV 259
            .|.:|.::|..|:.|...:.|
  Fly   450 ECADGLYWDESLQTCNYKNQV 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34324NP_001096972.1 CBM_14 209..262 CDD:279884 16/51 (31%)
CG7252NP_648527.1 CBM_14 30..79 CDD:279884
CBM_14 175..226 CDD:279884
CBM_14 251..296 CDD:279884
CBM_14 343..394 CDD:279884 6/50 (12%)
CBM_14 420..471 CDD:279884 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.