DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34324 and CG5883

DIOPT Version :10

Sequence 1:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster


Alignment Length:161 Identity:35/161 - (21%)
Similarity:49/161 - (30%) Gaps:58/161 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 PPPCTRTPPC---TTTPPCTPPCTTTKP--------C---TTTVCTTP---KSDNAGPIVD---- 185
            |..|:.:..|   .:||..|  |:.:||        |   ..|.|.|.   |....|.|.|    
  Fly    47 PGSCSESIICQNFESTPGIT--CSGSKPYYSKSKGSCQASADTYCDTSKICKGSGTGYIGDTINC 109

  Fly   186 GNEEQPDIDNPVAIAQVLISRHDCR-------------GQED---------------GTFLADVR 222
            .|....|.|       .|:.:..|.             ..||               ||...|..
  Fly   110 ANWYYCDAD-------ALLGKGTCNLGMYFDQVSKSCVYSEDTVCAAKYEICDVAPVGTPFRDDA 167

  Fly   223 HCRRYYVCNRQRSKRQNCPNGYWFDRELKAC 253
            :|.:||.|:.:......|.||.:::.....|
  Fly   168 NCHKYYTCSSKSLVENTCENGLYYNVATGTC 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34324NP_001096972.1 CBM_14 209..262 CDD:426342 14/73 (19%)
CG5883NP_648526.2 CBM_14 95..146 CDD:426342 11/57 (19%)
CBM_14 154..204 CDD:426342 11/45 (24%)

Return to query results.
Submit another query.