Sequence 1: | NP_001096972.1 | Gene: | CG34324 / 32302 | FlyBaseID: | FBgn0085353 | Length: | 267 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648504.2 | Gene: | Muc68D / 39326 | FlyBaseID: | FBgn0036203 | Length: | 1514 | Species: | Drosophila melanogaster |
Alignment Length: | 314 | Identity: | 72/314 - (22%) |
---|---|---|---|
Similarity: | 91/314 - (28%) | Gaps: | 128/314 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 PRADTPPCTPPPDPCTT---TTCPPPP------------------------PCTTTTCPPPEP-- 62
Fly 63 -----------------------PPCTTTTCPPPEPPPCT----------------TTTCPPPPP 88
Fly 89 PCITTTCPPPPPPPPPPPPPP------CTRTPPPCTRTPPPCTRTPPPCTRTPPPCTRTPPPCTR 147
Fly 148 TPPCTTTPPCTPPCTT--TKPCTTTV----CTTPKSDNAGPIVDGNEEQPDIDNPVAIAQVLISR 206
Fly 207 HDCRGQEDGTFLADVRHCRRYYVCNRQRSKRQNCPNGYWFDRELKACRLASTVN 260 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34324 | NP_001096972.1 | CBM_14 | 209..262 | CDD:279884 | 18/52 (35%) |
Muc68D | NP_648504.2 | ChtBD2 | 21..69 | CDD:214696 | |
PHA03249 | 1088..>1209 | CDD:223023 | 21/108 (19%) | ||
CBM_14 | 1314..1366 | CDD:279884 | 18/52 (35%) | ||
CBM_14 | 1388..1440 | CDD:279884 | |||
ChtBD2 | 1459..1505 | CDD:214696 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23301 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |