DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34324 and Muc68D

DIOPT Version :9

Sequence 1:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster


Alignment Length:314 Identity:72/314 - (22%)
Similarity:91/314 - (28%) Gaps:128/314 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PRADTPPCTPPPDPCTT---TTCPPPP------------------------PCTTTTCPPPEP-- 62
            |....|..:....||||   ::..|.|                        ||||.....||.  
  Fly  1100 PTESLPNSSTQGTPCTTDNPSSLEPSPSTPGNDDDSGNSGSENGNSSTSGSPCTTDNPSDPESSS 1164

  Fly    63 -----------------------PPCTTTTCPPPEPPPCT----------------TTTCPPPPP 88
                                   .||||.....||....|                |:|...|  
  Fly  1165 STPGNDDDSGNSGSENGNSSTSGSPCTTDNPSDPESSSSTPGNDDDSGNSGSESGITSTTGAP-- 1227

  Fly    89 PCITTTCPPPPPPPPPPPPPP------CTRTPPPCTRTPPPCTRTPPPCTRTPPPCTRTPPPCTR 147
              .||..|....|.|..|..|      .:.:||                 ....|||...|..:.
  Fly  1228 --YTTDNPASQEPSPSAPENPGDSGNSSSESPP-----------------EGATPCTPNAPKKST 1273

  Fly   148 TPPCTTTPPCTPPCTT--TKPCTTTV----CTTPKSDNAGPIVDGNEEQPDIDNPVAIAQVLISR 206
            |...|..|  ||..||  .|..|:|:    .|||          |::|               .|
  Fly  1274 TSSYTAHP--TPKYTTEGNKAETSTLKSPTGTTP----------GHQE---------------DR 1311

  Fly   207 HDCRGQEDGTFLADVRHCRRYYVCNRQRSKRQNCPNGYWFDRELKACRLASTVN 260
            .||....:|.||.|.:.|.:||||...::...:||....||.:.|.|...|.|:
  Fly  1312 TDCSNMPNGIFLRDFQSCNKYYVCLNGKAIAGHCPRNLHFDIKRKVCNFPSLVD 1365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34324NP_001096972.1 CBM_14 209..262 CDD:279884 18/52 (35%)
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023 21/108 (19%)
CBM_14 1314..1366 CDD:279884 18/52 (35%)
CBM_14 1388..1440 CDD:279884
ChtBD2 1459..1505 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.