DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34324 and CG13312

DIOPT Version :10

Sequence 1:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster


Alignment Length:233 Identity:47/233 - (20%)
Similarity:64/233 - (27%) Gaps:95/233 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LATIAGGH-------EALAHPPRADTPPCTPPPDPCTTTTCPPPPPCTTTTCPPPEPPPCTT--- 67
            :.|.|.|:       :....|.....|.|:...|..|||.   ....::||..||.....:|   
  Fly   124 VGTCASGYVCNINDTQICGLPADGVMPTCSYSDDSTTTTV---SSTTSSTTAAPPSTSSASTYCA 185

  Fly    68 ---------------TTCPPPEPPPCT---------TTTCP------PPPPPCITTTCPPPPPPP 102
                           |||  .:...||         |.|||      .....|::|.        
  Fly   186 AVQSQGKYAVGYNAYTTC--RQYIYCTLVDGSWIGQTYTCPGSMYFDSASEMCVSTM-------- 240

  Fly   103 PPPPPPPCTRTPPPCTRTPPPCTRTPPPCTRTP-------------PPCTRTPPPCTRTPPC--- 151
                |..|:.|....:      |.|..|.|..|             |..|.....|.:...|   
  Fly   241 ----PSTCSTTATTSS------TTTAAPTTSNPEAYCQAMQSAGYYPVGTDASTTCHQYIDCFLN 295

  Fly   152 --------TTTP------PCTPPCTTTKP--CTTTVCT 173
                    .|.|      ..:..|.:|.|  |:|||.:
  Fly   296 GGTWGGNMYTCPGSLYYNSASRTCVSTLPSTCSTTVAS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34324NP_001096972.1 CBM_14 209..262 CDD:426342
CG13312NP_648260.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.