DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34324 and CG13312

DIOPT Version :9

Sequence 1:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster


Alignment Length:233 Identity:47/233 - (20%)
Similarity:64/233 - (27%) Gaps:95/233 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LATIAGGH-------EALAHPPRADTPPCTPPPDPCTTTTCPPPPPCTTTTCPPPEPPPCTT--- 67
            :.|.|.|:       :....|.....|.|:...|..|||.   ....::||..||.....:|   
  Fly   124 VGTCASGYVCNINDTQICGLPADGVMPTCSYSDDSTTTTV---SSTTSSTTAAPPSTSSASTYCA 185

  Fly    68 ---------------TTCPPPEPPPCT---------TTTCP------PPPPPCITTTCPPPPPPP 102
                           |||  .:...||         |.|||      .....|::|.        
  Fly   186 AVQSQGKYAVGYNAYTTC--RQYIYCTLVDGSWIGQTYTCPGSMYFDSASEMCVSTM-------- 240

  Fly   103 PPPPPPPCTRTPPPCTRTPPPCTRTPPPCTRTP-------------PPCTRTPPPCTRTPPC--- 151
                |..|:.|....:      |.|..|.|..|             |..|.....|.:...|   
  Fly   241 ----PSTCSTTATTSS------TTTAAPTTSNPEAYCQAMQSAGYYPVGTDASTTCHQYIDCFLN 295

  Fly   152 --------TTTP------PCTPPCTTTKP--CTTTVCT 173
                    .|.|      ..:..|.:|.|  |:|||.:
  Fly   296 GGTWGGNMYTCPGSLYYNSASRTCVSTLPSTCSTTVAS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34324NP_001096972.1 CBM_14 209..262 CDD:279884
CG13312NP_648260.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.