DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34324 and CG32302

DIOPT Version :10

Sequence 1:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster


Alignment Length:150 Identity:34/150 - (22%)
Similarity:40/150 - (26%) Gaps:61/150 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PC--TRTP-----PCTTTPPCTPPCT----------------------TTKPCT-TTVCTTPKSD 178
            ||  .|.|     .|||...|....|                      .|..|| .:.|..||  
  Fly    25 PCQDVRIPGFVCMNCTTLGYCIRDATGSWETISMLGCQSEYNFYCSDEGTFGCTFQSQCQVPK-- 87

  Fly   179 NAGPIVDGNEEQPDIDNPVAIAQVLISRHDCRGQEDGTFLADVRHCRRYYVCNRQR-SKRQNCPN 242
             .||.                        .|  |:.|.| .|...||||:.|:.|. ...:.|.|
  Fly    88 -RGPF------------------------SC--QQAGLF-PDPYDCRRYHECSDQSVDTPRICSN 124

  Fly   243 GYWFDRELKACRLASTVNNC 262
            |..:......|.|......|
  Fly   125 GAGYSTLTGTCVLPRESEQC 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34324NP_001096972.1 CBM_14 209..262 CDD:426342 16/53 (30%)
CG32302NP_728732.1 CBM_14 94..144 CDD:426342 15/50 (30%)

Return to query results.
Submit another query.