DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34324 and CG32302

DIOPT Version :9

Sequence 1:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster


Alignment Length:150 Identity:34/150 - (22%)
Similarity:40/150 - (26%) Gaps:61/150 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PC--TRTP-----PCTTTPPCTPPCT----------------------TTKPCT-TTVCTTPKSD 178
            ||  .|.|     .|||...|....|                      .|..|| .:.|..||  
  Fly    25 PCQDVRIPGFVCMNCTTLGYCIRDATGSWETISMLGCQSEYNFYCSDEGTFGCTFQSQCQVPK-- 87

  Fly   179 NAGPIVDGNEEQPDIDNPVAIAQVLISRHDCRGQEDGTFLADVRHCRRYYVCNRQR-SKRQNCPN 242
             .||.                        .|  |:.|.| .|...||||:.|:.|. ...:.|.|
  Fly    88 -RGPF------------------------SC--QQAGLF-PDPYDCRRYHECSDQSVDTPRICSN 124

  Fly   243 GYWFDRELKACRLASTVNNC 262
            |..:......|.|......|
  Fly   125 GAGYSTLTGTCVLPRESEQC 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34324NP_001096972.1 CBM_14 209..262 CDD:279884 16/53 (30%)
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 15/50 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.