Sequence 1: | NP_001096972.1 | Gene: | CG34324 / 32302 | FlyBaseID: | FBgn0085353 | Length: | 267 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_609339.1 | Gene: | obst-B / 34336 | FlyBaseID: | FBgn0027600 | Length: | 337 | Species: | Drosophila melanogaster |
Alignment Length: | 250 | Identity: | 47/250 - (18%) |
---|---|---|---|
Similarity: | 63/250 - (25%) | Gaps: | 108/250 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 105 PPPPPCTRTPPPCTRTPPPCTRTPPPCTRTP-----PPCTRTPPP---------CTRTPPCTTTP 155
Fly 156 PCTPPCT------------------------------TTKP------------------------ 166
Fly 167 ----------CTTTVCTTPKS------DNAGPIVDG-------NEEQPDIDNPVAIAQVLISRHD 208
Fly 209 CRGQEDGTFLADVRHCRRYYVC-NRQRSKRQNCPNGYWFDRELKACRLASTVNNC 262 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34324 | NP_001096972.1 | CBM_14 | 209..262 | CDD:279884 | 16/53 (30%) |
obst-B | NP_609339.1 | CBM_14 | 89..139 | CDD:279884 | 5/49 (10%) |
CBM_14 | 156..204 | CDD:279884 | 4/47 (9%) | ||
CBM_14 | 233..278 | CDD:279884 | 16/55 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23301 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |