DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34324 and obst-E

DIOPT Version :9

Sequence 1:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster


Alignment Length:172 Identity:39/172 - (22%)
Similarity:53/172 - (30%) Gaps:47/172 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 TRTPPPCTRTP-PPC---TRTPPCTTTPPC-----------TPPCTTTKPCT------------- 168
            |:....||..| ..|   .|..|...|..|           ...|...:.|.             
  Fly    64 TKATGECTYAPYSTCKERARLQPANGTEECPRQFGFYPNGDATKCGVYRNCAHGVASLTKCPEGL 128

  Fly   169 -----TTVCTTP---KSDNAGPIVDGNEEQPDIDNPVAIAQVLISRHDCRGQEDGTFLADVRH-- 223
                 |..|..|   :|.||...:..|....|..:..|.|.|.:|       .:|. |...||  
  Fly   129 AFNEETYQCDWPDLVESCNAEAYLGFNCPAADSADDSAAAAVDVS-------PEGE-LRYYRHPQ 185

  Fly   224 -CRRYYVCNRQRSKRQNCPNGYWFDRELKACRLASTVNNCDA 264
             |::|:||.....:..||.....|:.:.|.|...:.|..|.|
  Fly   186 TCKKYFVCVNGHPRLYNCGKYLAFNSQTKLCDFYNKVPECYA 227

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG34324NP_001096972.1 CBM_14 209..262 CDD:279884 14/55 (25%)