DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34324 and Mur2B

DIOPT Version :10

Sequence 1:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_569927.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster


Alignment Length:231 Identity:62/231 - (26%)
Similarity:76/231 - (32%) Gaps:71/231 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PPRADT------PPCTPPPDPCTTTTCPPPPPCTTTTCPPPEP----PPCTTTTCPPPEPPPCTT 80
            |.|:.|      ||.|..|.|.||||....|..:|||....:|    |..||||       ..||
  Fly   735 PLRSSTETTSTQPPTTTTPQPTTTTTLTVTPKTSTTTTTTEKPITSSPKPTTTT-------QKTT 792

  Fly    81 TTCPPPPPPCITTTCPPPP-----------------PPPPPPPPPPCTRTPPPCTRTPPPCT--- 125
            :|.|......|||.....|                 |.|.....|..:.||.|.|.||...|   
  Fly   793 STAPNTTKVAITTQKETTPTQSTSTTIFTRKTTTNNPEPTSTEKPITSTTPKPSTTTPKTSTVAS 857

  Fly   126 -------RTPPPCTR--------------------------TPPPCTRTPPPCTRTPPCTTTPPC 157
                   .:|.|.|.                          |..|...|....|.||..||....
  Fly   858 STEKTTISSPKPTTEKSTENPTTNSVKTSALTSSTQRATSTTSEPTKTTQNITTTTPKPTTLKTS 922

  Fly   158 TPPCTT-TKPCTTTVCTTPKSDNAGPIVDGNEEQPD 192
            |...|| |:..:|...||.|:..:.|:...:.|:|:
  Fly   923 TQEATTSTQKVSTVTITTKKATESSPLTTLSTEEPN 958

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34324NP_001096972.1 CBM_14 209..262 CDD:426342
Mur2BNP_569927.1 ChtBD2 88..136 CDD:214696
CBM_14 150..197 CDD:426342
CBM_14 221..275 CDD:426342
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.