DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34324 and Muc68E

DIOPT Version :9

Sequence 1:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster


Alignment Length:255 Identity:58/255 - (22%)
Similarity:84/255 - (32%) Gaps:61/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EALAHPPRADTPP--CTPPPDPCTT----TTCPPPPPCTTTTCPPPEPPPCTTTTCPPPEPPPC- 78
            |.....|..||..  .||.||..||    ||........|||..|.|......:|..|.|.... 
  Fly  1516 ETTTEKPEDDTTAEGSTPIPDTSTTVNQDTTTDESSTVVTTTNIPKESTTLGDSTLSPGENSTAG 1580

  Fly    79 ---TTTTCPPPPPPCITTTCPPPPPPPPPPPPPPCTRTPPPCTRTPPPCTRTPPPCTRTPPPCTR 140
               |:||....     ||:.|.|.........|..:.:|...|.:.||.:     |: |......
  Fly  1581 QVSTSTTLVYD-----TTSSPIPSSSRSTTLEPSSSSSPETTTSSLPPLS-----CS-TGYQYLP 1634

  Fly   141 TPPPCTRTPPCTTTPPCTPPCTTTK-------PCT--TTVCTTPKSDNAGPIVDGNEEQ---PDI 193
            .|..|.:...|:........|....       .|:  :.||.. .::|:.|     ||:   |.:
  Fly  1635 HPTNCHKYIHCSNGHELIMECPANLYWDYHKFVCSGDSGVCYN-DTENSNP-----EEKVCGPGV 1693

  Fly   194 DNPVAIAQVLISRHDCRGQEDGTFLADVRHCRRYYVCNRQRSKRQNCPNGYWFDRELKAC 253
            |                      |||....|..|..|:...:..:.||:..:::.|:|:|
  Fly  1694 D----------------------FLAHPTDCTMYLQCSNGVALERKCPDPLYWNPEIKSC 1731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34324NP_001096972.1 CBM_14 209..262 CDD:279884 11/45 (24%)
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696
ChtBD2 1626..1668 CDD:214696 6/42 (14%)
ChtBD2 1688..1734 CDD:214696 13/66 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.