DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34324 and abu-5

DIOPT Version :9

Sequence 1:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_502873.1 Gene:abu-5 / 190870 WormBaseID:WBGene00000028 Length:335 Species:Caenorhabditis elegans


Alignment Length:274 Identity:57/274 - (20%)
Similarity:84/274 - (30%) Gaps:75/274 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CTPPPDPCTTTTCPPPP-----------PCTTTTCPPPEPPPCTTTTCPPPEPPPCTTTTCPPPP 87
            |.|.........|...|           .|.|::|..|..|  ....|.|...|.| ..:|..|.
 Worm    84 CAPACQQSCQRQCQSAPSVSNCQSSCQQTCQTSSCYTPVAP--APVQCQPSCMPVC-EQSCVAPA 145

  Fly    88 PPCITTTCPPPP-------PPPPPPPPPPCTRTPPPCTRTPPPC-TRTPPPCT-RTPPPCTRTPP 143
            |..|:......|       |....|..|.|.:....|.:..|.| .:..|.|| .:.|.|.:...
 Worm   146 PQVISLNLEVVPQCQQQCAPQCQQPSAPQCQQCQNTCQQYAPVCQQQCAPQCTFPSAPACQQCQT 210

  Fly   144 PCTRTPPCTTTPPCTPPCTTTKPCTTTVCTTPKSDNAGPIVDGNEEQPDIDNPV---AIAQVLIS 205
            .|.:|..|  ...|.|.|  .:|.... |...:|....|:|     .|.|...:   :::|....
 Worm   211 SCQQTQQC--QQQCIPQC--QQPAAPQ-CQQCQSACQSPVV-----APQIVTVILEPSVSQSAQC 265

  Fly   206 RHDCRGQEDGTFLADVRHCRRYYVCNRQRSKRQNCPNGYWFDRELKACR---------------- 254
            ...|:           :.|::.  |.:|:...|.|         ..||.                
 Worm   266 VPQCQ-----------QSCQQQ--CIQQQQPMQQC---------APACTQSCYQSCSTAQPVQMP 308

  Fly   255 -LASTVNNCDARRN 267
             |..:||:|..::|
 Worm   309 CLTQSVNSCSCQQN 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34324NP_001096972.1 CBM_14 209..262 CDD:279884 11/69 (16%)
abu-5NP_502873.1 DUF1096 19..69 CDD:284022
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.