DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set2 and SDG4

DIOPT Version :9

Sequence 1:NP_572888.2 Gene:Set2 / 32301 FlyBaseID:FBgn0030486 Length:2362 Species:Drosophila melanogaster
Sequence 2:NP_567859.1 Gene:SDG4 / 829210 AraportID:AT4G30860 Length:497 Species:Arabidopsis thaliana


Alignment Length:508 Identity:127/508 - (25%)
Similarity:207/508 - (40%) Gaps:132/508 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1129 GKESLSRQNSLDSSSS---ASQGAPKKKALKSAEILSAALLETESSESTSSGSKMSRWDVQTSPE 1190
            |..|:|...:|....|   |:.|....|::.|.|.|:          ...:|..:.    ...||
plant     5 GNMSMSASVALTCCPSFLPAASGPELAKSINSPENLA----------GECNGKHLP----MIPPE 55

  Fly  1191 LEAANPFGDIAKFIEDGVNLLKRDKVDEDQRKEG---QDEVKREADPEEDEFAQRVANMETPATT 1252
            .|..    ||.  |.:||....|.:...|:.|:|   .|.||       |...:|||:..:.:|.
plant    56 EEVK----DIK--IANGVTAFTRKQNPSDRVKKGFVLDDHVK-------DWVKRRVASGVSESTC 107

  Fly  1253 PTP---------------SPTQSNPEDSAST--------TTVLKELETGGGVRRSHRI------- 1287
            ..|               .|.....:.|.|.        :...||   ..|..:|.:.       
plant   108 FLPFLVGAKKMVDCLVCHKPVYPGEDLSCSVRGCQGAYHSLCAKE---SLGFSKSSKFKCPQHEC 169

  Fly  1288 ---KQKPQG-----PRASQ-----------------GRGV-----------ASVALAPISMDEQL 1316
               ||:.|.     |.|:.                 ||.|           ...|:|...::|..
plant   170 FVCKQRTQWRCVKCPMAAHDKHSPWSKEILHLKDQPGRAVCWRHPTDWRLDTKHAVAQSEIEEVF 234

  Fly  1317 AELANIEAINEQF---------LRSEGLNTFQLLKENFYRCARQVSQENAEMQCDCFLTGDEEAQ 1372
            .:|. :..:.|:|         :..|...::..::.|.|...::  ::||.....|...|.    
plant   235 CQLP-LPYVEEEFKIDLAWKDSVVKEDPPSYVHIRRNIYLVKKK--RDNANDGVGCTNCGP---- 292

  Fly  1373 GHLSCGAGCINRMLMIECGPLCSNGARCTNKRFQQHQCWPCRVFRTEKKGCGITAELLIPPGEFI 1437
               :|...|:.|:..|.|...||....|.|:.|::.:  ..::.:||..|.|:.|...|...:||
plant   293 ---NCDRSCVCRVQCISCSKGCSCPESCGNRPFRKEK--KIKIVKTEHCGWGVEAAESINKEDFI 352

  Fly  1438 MEYVGEVIDSEEFERR----QHLYSKDRNRHYYFMALRGEAVIDATSKGNISRYINHSCDPNAET 1498
            :||:||||...:.|:|    :|...||    :|...::.:..||||.|||.||::||||:||...
plant   353 VEYIGEVISDAQCEQRLWDMKHKGMKD----FYMCEIQKDFTIDATFKGNASRFLNHSCNPNCVL 413

  Fly  1499 QKWTVNGELRIGFFSVKPIQPGEEITFDYQYLRYGRDAQRCYCEAANCRGWIG 1551
            :||.|.||.|:|.|:.:.|:.||.:|:||:::::|.:. :|.|.:.||:|::|
plant   414 EKWQVEGETRVGVFAARQIEAGEPLTYDYRFVQFGPEV-KCNCGSENCQGYLG 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Set2NP_572888.2 AWS 1358..1410 CDD:197795 12/51 (24%)
SET 1414..1533 CDD:214614 49/122 (40%)
PostSET 1535..1551 CDD:214703 5/15 (33%)
WW 2014..2043 CDD:278809
SRI 2270..2348 CDD:285448
SDG4NP_567859.1 PHD2_NSD 121..167 CDD:277040 7/48 (15%)
AWS 286..326 CDD:197795 12/46 (26%)
SET 326..449 CDD:214614 49/128 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D507784at2759
OrthoFinder 1 1.000 - - FOG0002762
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22884
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.