DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set2 and ASHH3

DIOPT Version :9

Sequence 1:NP_572888.2 Gene:Set2 / 32301 FlyBaseID:FBgn0030486 Length:2362 Species:Drosophila melanogaster
Sequence 2:NP_566010.1 Gene:ASHH3 / 819021 AraportID:AT2G44150 Length:363 Species:Arabidopsis thaliana


Alignment Length:258 Identity:100/258 - (38%)
Similarity:138/258 - (53%) Gaps:18/258 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  1318 ELANIEAINEQFLRSEGLN-----TFQLLKENFY---RCARQVSQENAEMQCDCFLTGDEEAQGH 1374
            :|.|....:|:|...|.||     .:..::.|.|   :..|:|  |:..:.|.|  :........
plant    19 KLLNQIGESEEFELPEWLNKGKPTPYIFIRRNIYLTKKVKRRV--EDDGIFCSC--SSSSPGSSS 79

  Fly  1375 LSCGAGCINRMLMIECGPLCSNGARCTNKRFQQHQCWPCRVFRTEKKGCGITAELLIPPGEFIME 1439
            ..||:.|...||...|...|..|:.|.||.|||......::.:|||.|.||.||..|..||||:|
plant    80 TVCGSNCHCGMLFSSCSSSCKCGSECNNKPFQQRHVKKMKLIQTEKCGSGIVAEEEIEAGEFIIE 144

  Fly  1440 YVGEVIDSEEFERRQHLYSKDRNRHYYFMALRGEAVIDATSKGNISRYINHSCDPNAETQKWTVN 1504
            |||||||.:..|.|..........::|...:..:.|||||.|||.||||||||:||.:.|||.::
plant   145 YVGEVIDDKTCEERLWKMKHRGETNFYLCEITRDMVIDATHKGNKSRYINHSCNPNTQMQKWIID 209

  Fly  1505 GELRIGFFSVKPIQPGEEITFDYQYLRYGRDAQRCYCEAANCRGWIGGEPD-----SDEGEQL 1562
            ||.|||.|:.:.|:.||.:|:|||::::|.| |.|:|.|..||..:|.:|.     |||...|
plant   210 GETRIGIFATRGIKKGEHLTYDYQFVQFGAD-QDCHCGAVGCRRKLGVKPSKPKIASDEAFNL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Set2NP_572888.2 AWS 1358..1410 CDD:197795 16/51 (31%)
SET 1414..1533 CDD:214614 58/118 (49%)
PostSET 1535..1551 CDD:214703 7/15 (47%)
WW 2014..2043 CDD:278809
SRI 2270..2348 CDD:285448
ASHH3NP_566010.1 SET_ASHR3-like 117..255 CDD:380952 66/138 (48%)
Tudor_Agenet_AtEML-like 313..362 CDD:410475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002762
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22884
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.