DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set2 and SUV39H2

DIOPT Version :10

Sequence 1:NP_572888.2 Gene:Set2 / 32301 FlyBaseID:FBgn0030486 Length:2362 Species:Drosophila melanogaster
Sequence 2:NP_001180353.1 Gene:SUV39H2 / 79723 HGNCID:17287 Length:410 Species:Homo sapiens


Alignment Length:245 Identity:82/245 - (33%)
Similarity:106/245 - (43%) Gaps:46/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1344 NFYRCARQVSQEN-AEMQC---DCFLTGDEEAQGHLSCGAGCI-----NRMLMI-------ECGP 1392
            |.|:.|..:|..| |...|   |||.      |......||.:     |:.:.|       ||..
Human   173 NEYKPAPGISLVNEATFGCSCTDCFF------QKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNS 231

  Fly  1393 LCSNGARCTNKRFQQHQCWPCRVFRTEK-KGCGITAELLIPPGEFIMEYVGEVIDSEEFERRQHL 1456
            .|..|..|.|:..|:...:...:|||.. :|.|:...:.|....|:||||||||.|||.|||...
Human   232 RCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQF 296

  Fly  1457 YSKDRNRHYYFMAL---RGEAVIDATSKGNISRYINHSCDPNAETQKWTVNG---EL-RIGFFSV 1514
            |  |.....|...|   ..|..:||...||:|.::|||||||.:.....::.   .| ||..||.
Human   297 Y--DNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFST 359

  Fly  1515 KPIQPGEEITFDYQYLRYG--------------RDAQRCYCEAANCRGWI 1550
            :.|..|||:|||||....|              |....|.|.|..|||::
Human   360 RTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYL 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Set2NP_572888.2 valS <709..832 CDD:237855
AWS 1358..1410 CDD:197795 16/66 (24%)
SET_SETD2 1410..1551 CDD:380949 60/163 (37%)
WW 2014..2043 CDD:459800
SRI 2266..2355 CDD:462404
SUV39H2NP_001180353.1 CD_SUV39H1_like 47..95 CDD:349289
SET_SUV39H2 167..409 CDD:380930 82/243 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.