DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set2 and SUV39H2

DIOPT Version :9

Sequence 1:NP_572888.2 Gene:Set2 / 32301 FlyBaseID:FBgn0030486 Length:2362 Species:Drosophila melanogaster
Sequence 2:NP_001180353.1 Gene:SUV39H2 / 79723 HGNCID:17287 Length:410 Species:Homo sapiens


Alignment Length:245 Identity:82/245 - (33%)
Similarity:106/245 - (43%) Gaps:46/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1344 NFYRCARQVSQEN-AEMQC---DCFLTGDEEAQGHLSCGAGCI-----NRMLMI-------ECGP 1392
            |.|:.|..:|..| |...|   |||.      |......||.:     |:.:.|       ||..
Human   173 NEYKPAPGISLVNEATFGCSCTDCFF------QKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNS 231

  Fly  1393 LCSNGARCTNKRFQQHQCWPCRVFRTEK-KGCGITAELLIPPGEFIMEYVGEVIDSEEFERRQHL 1456
            .|..|..|.|:..|:...:...:|||.. :|.|:...:.|....|:||||||||.|||.|||...
Human   232 RCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQF 296

  Fly  1457 YSKDRNRHYYFMAL---RGEAVIDATSKGNISRYINHSCDPNAETQKWTVNG---EL-RIGFFSV 1514
            |  |.....|...|   ..|..:||...||:|.::|||||||.:.....::.   .| ||..||.
Human   297 Y--DNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFST 359

  Fly  1515 KPIQPGEEITFDYQYLRYG--------------RDAQRCYCEAANCRGWI 1550
            :.|..|||:|||||....|              |....|.|.|..|||::
Human   360 RTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYL 409

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Set2NP_572888.2 AWS 1358..1410 CDD:197795 16/66 (24%)
SET 1414..1533 CDD:214614 52/126 (41%)
PostSET 1535..1551 CDD:214703 6/16 (38%)
WW 2014..2043 CDD:278809
SRI 2270..2348 CDD:285448
SUV39H2NP_001180353.1 CD_SUV39H1_like 47..95 CDD:349289
SET_SUV39H2 167..409 CDD:380930 82/243 (34%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000269|PubMed:20084102, ECO:0007744|PDB:2R3A 261..263 0/1 (0%)