DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set2 and Setmar

DIOPT Version :9

Sequence 1:NP_572888.2 Gene:Set2 / 32301 FlyBaseID:FBgn0030486 Length:2362 Species:Drosophila melanogaster
Sequence 2:NP_848478.2 Gene:Setmar / 74729 MGIID:1921979 Length:309 Species:Mus musculus


Alignment Length:183 Identity:66/183 - (36%)
Similarity:96/183 - (52%) Gaps:26/183 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1387 MIECGPLCSNGARCTNKRFQQHQCWPCRVFRTEKKGCGITAELLIPPGEFIMEYVGEVIDSEEFE 1451
            :.||..||..|.||.|:..|....:..:||:|||||.|:.....||.|.|:.||.|||:...|.:
Mouse   116 VFECNVLCQCGMRCRNR
VVQNGLHFLLQVFQTEKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQ 180

  Fly  1452 RRQHLY-SKDRNRHYYFMALRG--------EAVIDATSKGNISRYINHSCDPNAETQKWTVNGEL 1507
            ||.||. |.|.|   |.:|:|.        |..:|.|..|||.|::||||:||.......::..:
Mouse   181 RRIHLQTSHDSN---YIIAVREHIYSGQIMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMV 242

  Fly  1508 -RIGFFSVKPIQPGEEITFDY--QYLRY--GRDAQR---------CYCEAANC 1546
             ::..|:.|.|.||||:::||  ::|..  .:|.::         |||.|.:|
Mouse   243 PKLALFAAKDILPGEELSYDYSGRFLN
QVSSKDKEKIDCSPPRKPCYCGAQSC 295

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Set2NP_572888.2 AWS 1358..1410 CDD:197795 9/22 (41%)
SET 1414..1533 CDD:214614 51/132 (39%)
PostSET 1535..1551 CDD:214703 6/21 (29%)
WW 2014..2043 CDD:278809
SRI 2270..2348 CDD:285448
SetmarNP_848478.2 Pre-SET 29..132 CDD:282838 7/15 (47%)
SET 142..269 CDD:214614 50/129 (39%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000250|UniProtKB:Q53H47 150..152 1/1 (100%)